PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016454927.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 323aa    MW: 35475.3 Da    PI: 10.4265
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016454927.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.94.1e-1298142347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+  ++ + ++lG+g+W+ I++    +Rt+ q+ s+ qky
   XP_016454927.1  98 SWTEEEHRSFLIGLEKLGKGDWRGISKSYVPTRTPSQVASHAQKY 142
                      7**************************9988*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.927621IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129416.86991147IPR017930Myb domain
SuperFamilySSF466898.97E-1793147IPR009057Homeodomain-like
TIGRFAMsTIGR015574.8E-1694145IPR006447Myb domain, plants
SMARTSM007171.1E-895145IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-1095141IPR009057Homeodomain-like
PfamPF002492.0E-1098142IPR001005SANT/Myb domain
CDDcd001672.23E-998143No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MTKDARKCSH CGQNGHNSRT CNYNSKGIKL FGVRIDDTNN SHHVDTKMKM KIVDHESAIR  60
RSKSLGNLEI HDHNAVVDAG YLSDGPIHSS INRKKGTSWT EEEHRSFLIG LEKLGKGDWR  120
GISKSYVPTR TPSQVASHAQ KYFIRMASND KKKRRPSVFD VNLKDSNSQI PSKASSSSLS  180
ISNMAPEVPK EASAPLEQLF DTCQIKGQAS KAAPCASRER PPLSPMTRPF GVPDIRHMPY  240
MMGVPRGLTA AKVIAPTVSW VPVFNFPPNQ NHLLNYRFAP FVARPPTAGL LSHPPPSSQV  300
QSQPGHSTPV TNNDGLNISI GAL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1150154KKKRR
2150155KKKRRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016454927.10.0PREDICTED: transcription factor MYB1R1-like isoform X1
TrEMBLK4C4M71e-145K4C4M7_SOLLC; Uncharacterized protein
STRINGSolyc06g034030.2.11e-145(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA117831823
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61620.15e-53MYB_related family protein